DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and BETA-TIP

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_173223.1 Gene:BETA-TIP / 838359 AraportID:AT1G17810 Length:267 Species:Arabidopsis thaliana


Alignment Length:234 Identity:87/234 - (37%)
Similarity:124/234 - (52%) Gaps:21/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GVADITENKKIWRMLLGELVGTFFLIFVGVGS-----------------TTSGSVPQIAFTFGLT 59
            |.||...:....|..|.|.:.||..:|.|.||                 .|.|.:..:|....|.
plant    12 GRADEATHPDSIRATLAEFLSTFVFVFAGEGSILALDKLYWDTAAHTGTNTPGGLVLVALAHALA 76

  Fly    60 VATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDL 124
            :........::||.|:|||||...||.|.||:::|.:|.:.|.:|||....::::|.:|:.....
plant    77 LFAAVSAAINVSGGHVNPAVTFAALIGGRISVIRAIYYWVAQLIGAILACLLLRLATNGLRPVGF 141

  Fly   125 GVSSFDPSLNCAQAVLIEALITFILVFVVKAVS-DPGRQDIKGSAPLAVGLAIAAGHLCAIKLSG 188
            .|:|....|:   .:|:|.::||.||:||.:.: ||.|..|...||||:||.:.|..|......|
plant   142 HVASGVSELH---GLLMEIILTFALVYVVYSTAIDPKRGSIGIIAPLAIGLIVGANILVGGPFDG 203

  Fly   189 ASMNPARSFGPAVVQGVWTYHWVYWVGPIAGGLLAGIIY 227
            |||||||:||||:|...|:.||:|||||..||.||.:||
plant   204 ASMNPARAFGPALVGWRWSNHWIYWVGPFIGGALAALIY 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 82/221 (37%)
BETA-TIPNP_173223.1 MIP 11..267 CDD:412216 87/234 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 148 1.000 Domainoid score I1435
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 150 1.000 Inparanoid score I1713
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.