DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and PIP2;4

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_200874.1 Gene:PIP2;4 / 836187 AraportID:AT5G60660 Length:291 Species:Arabidopsis thaliana


Alignment Length:246 Identity:75/246 - (30%)
Similarity:120/246 - (48%) Gaps:30/246 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DITENKK--IWRMLLGELVGTFFLIFVGV---------GSTTSGSVP-------QIAFTFGLTVA 61
            |:.|.:|  ::|.::.|.|.|...::|.:         ...|:|.|.       .||:.||..:.
plant    28 DMEELRKWPLYRAVIAEFVATLLFLYVSILTVIGYKAQTDATAGGVDCGGVGILGIAWAFGGMIF 92

  Fly    62 TIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGV---AGGD 123
            .:......:||.|||||||:|..:..::|:::...||:.||:|||.|...:|......   .|| 
plant    93 VLVYCTAGISGGHINPAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGFVKAFQSSYYTRYGG- 156

  Fly   124 LGVSSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGR----QDIKGSAPLAVGLAIAAGHLCAI 184
             |.:......|....:..|.:.||:||:.|.:.:||.|    ..:...|||.:|.|:...||..|
plant   157 -GANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATI 220

  Fly   185 KLSGASMNPARSFGPAVV---QGVWTYHWVYWVGPIAGGLLAGIIYRLIFK 232
            .::|..:|||||||.||:   :..|...|::||||:.|...|...::.|.:
plant   221 PITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPMIGAAAAAFYHQFILR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 71/229 (31%)
PIP2;4NP_200874.1 MIP 31..266 CDD:395174 73/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm1071
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.690

Return to query results.
Submit another query.