DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and NIP4;1

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_198597.1 Gene:NIP4;1 / 833759 AraportID:AT5G37810 Length:283 Species:Arabidopsis thaliana


Alignment Length:212 Identity:76/212 - (35%)
Similarity:117/212 - (55%) Gaps:11/212 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLGELVGTFFLIFVGVGSTT-----SGSV--PQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGF 83
            |:.|::||:|::|.|.|...     .|::  |.|..|:||.|..:....||:||.|.|||||:.|
plant    45 LIAEMIGTYFIVFSGCGVVVVNVLYGGTITFPGICVTWGLIVMVMIYSTGHISGAHFNPAVTVTF 109

  Fly    84 LIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNCAQAVLIEALITFI 148
            .|.......:...||..|..|::..:..:::..........|.:   |:.:.|:|::.|.:|:|:
plant   110 AIFRRFPWHQVPLYIGAQFAGSLLASLTLRLMFKVTPEAFFGTT---PADSPARALVAEIIISFL 171

  Fly   149 LVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTYHWVYW 213
            |:||:..|:...|. :...|.:|||:.|......|..:||||||||||.|||:|.||:.:.|||.
plant   172 LMFVISGVATDNRA-VGELAGIAVGMTIMVNVFVAGPISGASMNPARSLGPALVMGVYKHIWVYI 235

  Fly   214 VGPIAGGLLAGIIYRLI 230
            |||:.|.:..|.:|.||
plant   236 VGPVLGVISGGFVYNLI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 73/207 (35%)
NIP4;1NP_198597.1 PLN00182 1..283 CDD:165748 76/212 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.