DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and PIP3

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001190920.1 Gene:PIP3 / 829662 AraportID:AT4G35100 Length:280 Species:Arabidopsis thaliana


Alignment Length:241 Identity:79/241 - (32%)
Similarity:121/241 - (50%) Gaps:26/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DITENK--KIWRMLLGELVGTFFLIFVGVGSTTSGSVPQ-----------IAFTFGLTVATIAQG 66
            |:.|.|  ..:|.|:.|.:.|...::|.| :|..|...|           ||:.||..:..:...
plant    27 DMGELKSWSFYRALIAEFIATLLFLYVTV-ATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYC 90

  Fly    67 LGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALD---GVAGGDLGVSS 128
            ...:||.|||||||.|..:..::|:::|..|:|.||:|||.|...:|..:.   ...||  |.::
plant    91 TAGISGGHINPAVTFGLFLARKVSLVRALGYMIAQCLGAICGVGFVKAFMKTPYNTLGG--GANT 153

  Fly   129 FDPSLNCAQAVLIEALITFILVFVVKAVSDPGR----QDIKGSAPLAVGLAIAAGHLCAIKLSGA 189
            .....:...|:..|.:.||:||:.|.:.:||.|    ..|...|||.:|.|:...||..|.::|.
plant   154 VADGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGT 218

  Fly   190 SMNPARSFGPAVV---QGVWTYHWVYWVGPIAGGLLAGIIYRLIFK 232
            .:|||||||.||:   :..|...|::||||..|.|.|...::.|.:
plant   219 GINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 75/224 (33%)
PIP3NP_001190920.1 MIP 30..259 CDD:395174 77/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm1071
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.690

Return to query results.
Submit another query.