DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and PIP1;5

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_194071.1 Gene:PIP1;5 / 828439 AraportID:AT4G23400 Length:287 Species:Arabidopsis thaliana


Alignment Length:283 Identity:83/283 - (29%)
Similarity:125/283 - (44%) Gaps:71/283 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VGVADITENK----------------KIW---RMLLGELVGTFFLIFVGV----------GSTTS 46
            :|.|..||:|                |.|   |..:.|.:.||..::|.|          ....|
plant    21 IGTAAQTESKDYKEPPPAPFFEPGELKSWSFYRAGIAEFIATFLFLYVTVLTVMGVKRAPNMCAS 85

  Fly    47 GSVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAV 111
            ..:..||:.||..:..:......:||.|||||||.|..:..::|:.:|.|||::||:|||.||.|
plant    86 VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRALFYIVMQCLGAICGAGV 150

  Fly   112 IK----------------VALDGVAGGDLGVSSFDPSLNCAQAVLIEALITFILVFVVKAVSDPG 160
            :|                ||.....|..||.               |.:.||:||:.|.:.:|..
plant   151 VKGFQPGLYQTNGGGANVVAHGYTKGSGLGA---------------EIVGTFVLVYTVFSATDAK 200

  Fly   161 R----QDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQG---VWTYHWVYWVGPIA 218
            |    ..:...|||.:|.|:...||..|.::|..:|||||.|.|::..   .|..||::||||..
plant   201 RSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNKDHAWDDHWIFWVGPFI 265

  Fly   219 GGLLAGIIYRLIFKLKKGCTPFQ 241
            |..||.:.::::.:    ..||:
plant   266 GAALAALYHQIVIR----AIPFK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 75/239 (31%)
PIP1;5NP_194071.1 MIP 45..274 CDD:395174 76/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37507
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm1071
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.