DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and PIP1;4

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_567178.1 Gene:PIP1;4 / 827956 AraportID:AT4G00430 Length:287 Species:Arabidopsis thaliana


Alignment Length:274 Identity:78/274 - (28%)
Similarity:123/274 - (44%) Gaps:62/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVEKTEMSKFVGVADITENKKIWRMLLGELVGTFFLIFVGV----------GSTTSGSVPQIAFT 55
            :.|..|:|.:          ..:|..:.|.:.||..:::.|          ....|..:..||:.
plant    40 LFEPGELSSW----------SFYRAGIAEFIATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWA 94

  Fly    56 FGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIK------- 113
            ||..:..:......:||.|||||||.|..:..::|:.:|.||:|:||:|||.||.|:|       
plant    95 FGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPY 159

  Fly   114 ---------VALDGVAGGDLGVSSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGR----QDIK 165
                     ||.....|..||.               |.:.||:||:.|.:.:|..|    ..:.
plant   160 QTLGGGANTVAHGYTKGSGLGA---------------EIIGTFVLVYTVFSATDAKRSARDSHVP 209

  Fly   166 GSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQG---VWTYHWVYWVGPIAGGLLAGIIY 227
            ..|||.:|.|:...||..|.::|..:|||||.|.|::..   .|..||::||||..|..||.:.:
plant   210 ILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNKDHSWDDHWIFWVGPFIGAALAALYH 274

  Fly   228 RLIFKLKKGCTPFQ 241
            :::.:    ..||:
plant   275 QIVIR----AIPFK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 73/236 (31%)
PIP1;4NP_567178.1 MIP 45..274 CDD:395174 75/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37507
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm1071
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.