DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and NLM1

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_567572.1 Gene:NLM1 / 827641 AraportID:AT4G19030 Length:296 Species:Arabidopsis thaliana


Alignment Length:217 Identity:77/217 - (35%)
Similarity:115/217 - (52%) Gaps:14/217 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLGELVGTFFLIFVGVGSTTSG-------SVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGF 83
            |:.|.:||:||:|.|..|....       ::|.||..:|||:..:...|||:||.|||||||:.|
plant    57 LIAEFLGTYFLVFTGCASVVVNMQNDNVVTLPGIAIVWGLTIMVLIYSLGHISGAHINPAVTIAF 121

  Fly    84 LIVGEISILKAAFYIIVQCVGAIAGAAVIKV--ALD-GVAGG--DLGVSSFDPSLNCAQAVLIEA 143
            ...|...:.:...|:|.|.:|:...||.:::  .|| .|..|  |:.:.| .|..:..||..:|.
plant   122 ASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDHDVCSGKHDVFIGS-SPVGSDLQAFTMEF 185

  Fly   144 LITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTY 208
            ::||.|:|::..|:...|. |...|.||:|..:....|.|..:|.|||||.||.|||:|.|.:..
plant   186 IVTFYLMFIISGVATDNRA-IGELAGLAIGSTVLLNVLIAAPVSSASMNPGRSLGPALVYGCYKG 249

  Fly   209 HWVYWVGPIAGGLLAGIIYRLI 230
            .|:|.|.|..|.:....:|..:
plant   250 IWIYLVAPTLGAIAGAWVYNTV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 76/212 (36%)
NLM1NP_567572.1 PLN00184 1..296 CDD:177778 77/217 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.