DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and NIP5;1

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_192776.1 Gene:NIP5;1 / 826630 AraportID:AT4G10380 Length:304 Species:Arabidopsis thaliana


Alignment Length:211 Identity:73/211 - (34%)
Similarity:99/211 - (46%) Gaps:12/211 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RMLLGELVGTFFLIFVG-----VGSTTSGSVPQI--AFTFGLTVATIAQGLGHLSGCHINPAVTL 81
            |.|..|.||||.|||..     |.....|:...|  |...||.|..|....||:||.|:||::|:
plant    78 RKLGAEFVGTFILIFTATAGPIVNQKYDGAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTI 142

  Fly    82 GFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNCAQAVLIEALIT 146
            .|..:..........||..|...:|..:..:|........|.:.:    ||::..||..:|.:||
plant   143 AFAALRHFPWAHVPAYIAAQVSASICASFALKGVFHPFMSGGVTI----PSVSLGQAFALEFIIT 203

  Fly   147 FILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTYHWV 211
            |||:|||.||:...|. :...|.:|||..:....|.|...:|.||||.|:.||||..|.:...||
plant   204 FILLFVVTAVATDTRA-VGELAGIAVGATVMLNILVAGPSTGGSMNPVRTLGPAVASGNYRSLWV 267

  Fly   212 YWVGPIAGGLLAGIIY 227
            |.|.|..|.:....:|
plant   268 YLVAPTLGAISGAAVY 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 72/209 (34%)
NIP5;1NP_192776.1 PLN00026 29..304 CDD:177663 73/211 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.