DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and PIP1A

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001078323.1 Gene:PIP1A / 825316 AraportID:AT3G61430 Length:286 Species:Arabidopsis thaliana


Alignment Length:253 Identity:78/253 - (30%)
Similarity:121/253 - (47%) Gaps:54/253 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 WRMLLGELVGTFFLIFVGV----------GSTTSGSVPQIAFTFGLTVATIAQGLGHLSGCHINP 77
            ||..:.|.:.||..:::.|          ....|..:..||:.||..:..:......:||.||||
plant    51 WRAGIAEFIATFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINP 115

  Fly    78 AVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIK-------VALDGVA---------GGDLGV 126
            |||.|..:..::|:.:|.:||::||:|||.||.|:|       .||.|.|         |..||.
plant   116 AVTFGLFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAHGYTKGSGLGA 180

  Fly   127 SSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGS-----APLAVGLAIAAGHLCAIKL 186
                           |.:.||:||:.|.:.:| .:::.:.|     |||.:|.|:...||..|.:
plant   181 ---------------EIIGTFVLVYTVFSATD-AKRNARDSHVPILAPLPIGFAVFLVHLATIPI 229

  Fly   187 SGASMNPARSFGPAVVQG---VWTYHWVYWVGPIAGGLLAGIIYRLIFKLKKGCTPFQ 241
            :|..:|||||.|.|::..   .|..|||:||||..|..||.:.:.::.:    ..||:
plant   230 TGTGINPARSLGAAIIYNKDHSWDDHWVFWVGPFIGAALAALYHVVVIR----AIPFK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 76/237 (32%)
PIP1ANP_001078323.1 MIP 44..273 CDD:395174 76/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37507
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm1071
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.