DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and PIP2;5

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_191042.1 Gene:PIP2;5 / 824647 AraportID:AT3G54820 Length:286 Species:Arabidopsis thaliana


Alignment Length:259 Identity:75/259 - (28%)
Similarity:124/259 - (47%) Gaps:40/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVEKTEMSKFVGVADITENKKIWRMLLGELVGTFFLIFVGV----------------GSTTSGSV 49
            :.:.||:.|:          ..:|.|:.|.:.|...::|.:                ...|...|
plant    25 LFDATELGKW----------SFYRALIAEFIATLLFLYVTIMTVIGYKSQTDPALNPDQCTGVGV 79

  Fly    50 PQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKV 114
            ..||:.||..:..:......:||.|||||||.|.|:..::::::|..|::.||:|||.|.|::|.
plant    80 LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKVTLVRAVMYMVAQCLGAICGVALVKA 144

  Fly   115 ALDG----VAGGDLGVSSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGR----QDIKGSAPLA 171
            ....    ..||..|:|.   ..:....|..|.:.||:||:.|.:.:||.|    ..:...|||.
plant   145 FQSAYFTRYGGGANGLSD---GYSIGTGVAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLP 206

  Fly   172 VGLAIAAGHLCAIKLSGASMNPARSFGPAVVQG---VWTYHWVYWVGPIAGGLLAGIIYRLIFK 232
            :|.|:...||..|.::|..:|||||.|.|::..   .|.:||::||||.||..:|...::.:.:
plant   207 IGFAVFIVHLATIPITGTGINPARSLGAAIIYNKDKAWDHHWIFWVGPFAGAAIAAFYHQFVLR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 72/230 (31%)
PIP2;5NP_191042.1 MIP 30..265 CDD:395174 74/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm1071
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.690

Return to query results.
Submit another query.