DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and PIP2A

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001030851.1 Gene:PIP2A / 824510 AraportID:AT3G53420 Length:287 Species:Arabidopsis thaliana


Alignment Length:262 Identity:82/262 - (31%)
Similarity:123/262 - (46%) Gaps:37/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DITENKK--IWRMLLGELVGTFFLIFVGV---------GSTTSGSVP-------QIAFTFGLTVA 61
            |..|.||  .:|.::.|.|.|...:::.|         ..|.:|.|.       .||:.||..:.
plant    28 DGAELKKWSFYRAVIAEFVATLLFLYITVLTVIGYKIQSDTDAGGVDCGGVGILGIAWAFGGMIF 92

  Fly    62 TIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGV---AGGD 123
            .:......:||.|||||||.|..:..::|:.:|..|||.||:|||.|...:|......   .|| 
plant    93 ILVYCTAGISGGHINPAVTFGLFLARKVSLPRALLYIIAQCLGAICGVGFVKAFQSSYYTRYGG- 156

  Fly   124 LGVSSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGR----QDIKGSAPLAVGLAIAAGHLCAI 184
             |.:|.....:....:..|.:.||:||:.|.:.:||.|    ..:...|||.:|.|:...||..|
plant   157 -GANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATI 220

  Fly   185 KLSGASMNPARSFGPAVVQG---VWTYHWVYWVGPIAGGLLAGIIYRLIFKLKKGCTPFQGHESL 246
            .::|..:|||||||.||:..   .|..||::||||..|..:|...::.:.:.       .|.:||
plant   221 PITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLRA-------SGSKSL 278

  Fly   247 WS 248
            .|
plant   279 GS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 74/229 (32%)
PIP2ANP_001030851.1 MIP 31..266 CDD:395174 77/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm1071
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.690

Return to query results.
Submit another query.