DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and TIP2

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_189283.1 Gene:TIP2 / 822259 AraportID:AT3G26520 Length:253 Species:Arabidopsis thaliana


Alignment Length:254 Identity:98/254 - (38%)
Similarity:133/254 - (52%) Gaps:26/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GVADITENKKIWRMLLGELVGTFFLIFVGVGS-------------TTSGSV-PQIAFTFGLTVAT 62
            ||.:...:....|..|.|.:.|...:|.|.||             |.||.| ..:|..|||.|| 
plant    10 GVQEEVYHPNALRAALAEFISTLIFVFAGSGSGIAFNKITDNGATTPSGLVAAALAHAFGLFVA- 73

  Fly    63 IAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVS 127
            ::.| .::||.|:|||||.|.|:.|.|::|:...|.|.|.:|::|...::..|..|......|:|
plant    74 VSVG-ANISGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPAFGLS 137

  Fly   128 SFDPSLNCAQAVLIEALITFILVFVVKAVS-DPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASM 191
            :...|||   |::.|.::||.||:.|.|.: ||....:...||:|:|..:.|..|.....|||||
plant   138 AGVGSLN---ALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASM 199

  Fly   192 NPARSFGPAVVQGVWTYHWVYWVGPIAGGLLAGIIYRLIFKLKKGCTPFQGHESLWSLD 250
            |||.:||||||...||.|||||.||:.||.||||||..:|      .....||.|.:.|
plant   200 NPAVAFGPAVVSWTWTNHWVYWAGPLIGGGLAGIIYDFVF------IDENAHEQLPTTD 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 89/218 (41%)
TIP2NP_189283.1 PLN00027 1..253 CDD:177664 98/254 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 148 1.000 Domainoid score I1435
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 150 1.000 Inparanoid score I1713
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.