DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and DELTA-TIP

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_188245.1 Gene:DELTA-TIP / 820870 AraportID:AT3G16240 Length:250 Species:Arabidopsis thaliana


Alignment Length:223 Identity:91/223 - (40%)
Similarity:124/223 - (55%) Gaps:20/223 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RMLLGELVGTFFLIFVGVGST-------------TSGSVP-QIAFTFGLTVATIAQGLGHLSGCH 74
            |..|.|.:.|...:|.||||.             |.|.|. .:...|.|.|| :|.| .::||.|
plant    19 RAYLAEFISTLLFVFAGVGSAIAYAKLTSDAALDTPGLVAIAVCHGFALFVA-VAIG-ANISGGH 81

  Fly    75 INPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNCAQAV 139
            :|||||.|..:.|:|:::...||.|.|.:|:.|...::|....|:|   :...|....|...:.|
plant    82 VNPAVTFGLAVGGQITVITGVFYWIAQLLGSTAACFLLKYVTGGLA---VPTHSVAAGLGSIEGV 143

  Fly   140 LIEALITFILVFVVKA-VSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQ 203
            ::|.:|||.||:.|.| .:||.:..:...||||:||.:.|..|.|...||.||||||||||||..
plant   144 VMEIIITFALVYTVYATAADPKKGSLGTIAPLAIGLIVGANILAAGPFSGGSMNPARSFGPAVAA 208

  Fly   204 GVWTYHWVYWVGPIAGGLLAGIIYRLIF 231
            |.::.||||||||:.||.|||:||..:|
plant   209 GDFSGHWVYWVGPLIGGGLAGLIYGNVF 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 88/217 (41%)
DELTA-TIPNP_188245.1 MIP 1..244 CDD:412216 91/223 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 148 1.000 Domainoid score I1435
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 150 1.000 Inparanoid score I1713
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.