DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and NIP7;1

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_566271.1 Gene:NIP7;1 / 819783 AraportID:AT3G06100 Length:275 Species:Arabidopsis thaliana


Alignment Length:223 Identity:78/223 - (34%)
Similarity:122/223 - (54%) Gaps:15/223 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RMLLGELVGTFFLIF--VGVGSTT--SG---SVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTL 81
            |:::.||||||.|:|  .||.|:|  ||   .:.:.|.|.||:|..:...:||:||.|:||::|:
plant    46 RIVMAELVGTFILMFSVCGVISSTQLSGGHVGLLEYAVTAGLSVVVVVYSIGHISGAHLNPSITI 110

  Fly    82 GFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNCAQAVLIEALIT 146
            .|.:.|.....:...||..|.:||.| |.::.|::.||   :..:.:..|:|:|..|..:|.:.|
plant   111 AFAVFGGFPWSQVPLYITAQTLGATA-ATLVGVSVYGV---NADIMATKPALSCVSAFFVELIAT 171

  Fly   147 FILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTYH-- 209
            .|:||:..|:.....|::.......:|..|:.|.|....:||.|||||||.|||||  .|.:.  
plant   172 SIVVFLASALHCGPHQNLGNLTGFVIGTVISLGVLITGPISGGSMNPARSLGPAVV--AWDFEDL 234

  Fly   210 WVYWVGPIAGGLLAGIIYRLIFKLKKGC 237
            |:|...|:.|.::..:.||.|....:.|
plant   235 WIYMTAPVIGAIIGVLTYRSISLKTRPC 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 74/211 (35%)
NIP7;1NP_566271.1 PLN00183 1..275 CDD:215092 78/223 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.