DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and PIP2E

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_181434.1 Gene:PIP2E / 818487 AraportID:AT2G39010 Length:289 Species:Arabidopsis thaliana


Alignment Length:264 Identity:80/264 - (30%)
Similarity:125/264 - (47%) Gaps:38/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DITENKK--IWRMLLGELVGTFFLIFV----------------GVGSTTSGSVPQIAFTFGLTVA 61
            ::.|.||  .:|.::.|.:.|...::|                |.|:..|..:..|::.||..:.
plant    27 EVRELKKWSFYRAVIAEFIATLLFLYVTVLTVIGFKSQTDINAGGGACASVGLLGISWAFGGMIF 91

  Fly    62 TIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKV---ALDGVAGGD 123
            .:......:||.|||||||.|..:..::|:::|..|::.||:||..|..::||   ......|| 
plant    92 ILVYCTAGISGGHINPAVTFGLFLASKVSLVRAVSYMVAQCLGATCGVGLVKVFQSTYYNRYGG- 155

  Fly   124 LGVSSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGR----QDIKGSAPLAVGLAIAAGHLCAI 184
             |.:......|....|..|.:.||:||:.|.:.:||.|    ..|...|||.:|.::...||..|
plant   156 -GANMLSDGYNVGVGVGAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFSVFMVHLATI 219

  Fly   185 KLSGASMNPARSFGPAVV---QGVWTYHWVYWVGPIAGGLLAGIIYRLIFKLKKGCTPFQG---- 242
            .::|..:|||||||.||:   |..|...|::||||..|..:|...::  |.|:.|.....|    
plant   220 PITGTGINPARSFGAAVIYNNQKAWDDQWIFWVGPFVGAAIAAFYHQ--FVLRAGAMKAYGSVRS 282

  Fly   243 --HE 244
              ||
plant   283 QLHE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 71/229 (31%)
PIP2ENP_181434.1 MIP 30..265 CDD:395174 74/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm1071
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.690

Return to query results.
Submit another query.