DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and PIP2B

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001323849.1 Gene:PIP2B / 818293 AraportID:AT2G37170 Length:328 Species:Arabidopsis thaliana


Alignment Length:261 Identity:79/261 - (30%)
Similarity:123/261 - (47%) Gaps:35/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ADITENKKIWRMLLGELVGTFFLIFVGV---------GSTTSGSVP-------QIAFTFGLTVAT 62
            ||......::|.::.|.|.|...:::.|         ..|.:|.|.       .||:.||..:..
plant    70 ADELTKWSLYRAVIAEFVATLLFLYITVLTVIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFI 134

  Fly    63 IAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGV---AGGDL 124
            :......:||.|||||||.|..:..::|:::|..|::.||:|||.|...:|......   .||  
plant   135 LVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYYDRYGG-- 197

  Fly   125 GVSSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGR----QDIKGSAPLAVGLAIAAGHLCAIK 185
            |.:|.....|....:..|.:.||:||:.|.:.:||.|    ..:...|||.:|.|:...||..|.
plant   198 GANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP 262

  Fly   186 LSGASMNPARSFGPAVVQG---VWTYHWVYWVGPIAGGLLAGIIYRLIFKLKKGCTPFQGHESLW 247
            ::|..:|||||||.||:..   .|..||::||||..|..:|...::.:.:.       .|.:||.
plant   263 ITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLRA-------SGSKSLG 320

  Fly   248 S 248
            |
plant   321 S 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 73/229 (32%)
PIP2BNP_001323849.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm1071
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.690

Return to query results.
Submit another query.