DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and GAMMA-TIP

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_181221.1 Gene:GAMMA-TIP / 818255 AraportID:AT2G36830 Length:251 Species:Arabidopsis thaliana


Alignment Length:236 Identity:90/236 - (38%)
Similarity:125/236 - (52%) Gaps:20/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VGVADITENKKIWRMLLGELVGTFFLIFVGVGS-------------TTSGSV-PQIAFTFGLTVA 61
            :|..|........:..|.|.:.|...:..|.||             |.||.| ..:|..|||.||
plant     8 IGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAAAVAHAFGLFVA 72

  Fly    62 TIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGV 126
             ::.| .::||.|:|||||.|..|.|.|::|:...|.|.|.:|::....::|.|..|:|....|:
plant    73 -VSVG-ANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLILKFATGGLAVPAFGL 135

  Fly   127 SSFDPSLNCAQAVLIEALITFILVFVVKAVS-DPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGAS 190
            |:....||   |.:.|.::||.||:.|.|.: ||....:...||:|:|..:.|..|.....||||
plant   136 SAGVGVLN---AFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGAS 197

  Fly   191 MNPARSFGPAVVQGVWTYHWVYWVGPIAGGLLAGIIYRLIF 231
            ||||.:||||||...||.|||||.||:.||.:||:||.:.|
plant   198 MNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFF 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 85/218 (39%)
GAMMA-TIPNP_181221.1 PLN00027 1..251 CDD:177664 90/236 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 148 1.000 Domainoid score I1435
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 150 1.000 Inparanoid score I1713
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.