DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and NIP2;1

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_180986.1 Gene:NIP2;1 / 818002 AraportID:AT2G34390 Length:288 Species:Arabidopsis thaliana


Alignment Length:220 Identity:72/220 - (32%)
Similarity:115/220 - (52%) Gaps:21/220 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLGELVGTFFLIFVGVGSTTSG-------SVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGF 83
            ||.|||||::|||.|..:....       ::..||..:|:.:..:...||||| .|.||||||..
plant    50 LLAELVGTYYLIFAGCAAIAVNAQHNHVVTLVGIAVVWGIVIMVLVYCLGHLS-AHFNPAVTLAL 113

  Fly    84 LIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFD------PSLNCAQAVLIE 142
            .......:.:...||.||.:|:...:|.:::..|  ...|:.....|      ||.:..||.::|
plant   114 ASSQRFPLNQVPAYITVQVIGSTLASATLRLLFD--LNNDVCSKKHDVFLGSSPSGSDLQAFVME 176

  Fly   143 ALITFILVFVVKAVSDPGR--QDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGV 205
            .:||..|:.||.||:...|  ::::|   |.:|..:....:.|.::||||||||||.|||:|.|.
plant   177 FIITGFLMLVVCAVTTTKRTTEELEG---LIIGATVTLNVIFAGEVSGASMNPARSIGPALVWGC 238

  Fly   206 WTYHWVYWVGPIAGGLLAGIIYRLI 230
            :...|:|.:.|..|.:...:|::::
plant   239 YKGIWIYLLAPTLGAVSGALIHKML 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 71/215 (33%)
NIP2;1NP_180986.1 MIP 6..283 CDD:412216 72/220 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.