DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and AT2G29870

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_180548.1 Gene:AT2G29870 / 817537 AraportID:AT2G29870 Length:139 Species:Arabidopsis thaliana


Alignment Length:113 Identity:38/113 - (33%)
Similarity:64/113 - (56%) Gaps:5/113 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 AGGDLGVSSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGR--QDIKGSAPLAVGLAIAAGHLC 182
            |...:..|...||.:..||.::|.:||..|:.||.||:...|  ::::|   |.:|..:....:.
plant     5 ARNTMSSSGSSPSGSDLQAFVMEFIITGFLMLVVCAVTTTKRTTEELEG---LIIGATVTLNVIF 66

  Fly   183 AIKLSGASMNPARSFGPAVVQGVWTYHWVYWVGPIAGGLLAGIIYRLI 230
            ..::||||||||||.|||:|.|.:...|:|.:.|..|.:...:|::::
plant    67 VGEVSGASMNPARSIGPALVWGCYKGIWIYLLAPTLGAVSRALIHKML 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 37/108 (34%)
AT2G29870NP_180548.1 MIP <20..134 CDD:294134 34/98 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.