DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and TIP4;1

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_180152.1 Gene:TIP4;1 / 817123 AraportID:AT2G25810 Length:249 Species:Arabidopsis thaliana


Alignment Length:214 Identity:85/214 - (39%)
Similarity:116/214 - (54%) Gaps:14/214 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RMLLGELVGTFFLIFVGVGS---------TTSGSVPQIAFTFGLTVATIAQGLGHLSGCHINPAV 79
            :.|:.|.:.||..:|.||||         .|...:..:|......||.:... ||:||.|:||||
plant    19 KALIVEFITTFLFVFAGVGSAMATDSLVGNTLVGLFAVAVAHAFVVAVMISA-GHISGGHLNPAV 82

  Fly    80 TLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNCAQAVLIEAL 144
            |||.|:.|.||:.:|..|.|.|.:.:.|...::.....|:.   ..|.:....::..|.::.|.:
plant    83 TLGLLLGGHISVFRAFLYWIDQLLASSAACFLLSYLTGGMG---TPVHTLASGVSYTQGIIWEII 144

  Fly   145 ITFILVFVVKA-VSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTY 208
            :||.|:|.|.| :.||.:..:.|..||..|..:.|..|.....||||||||||||||:|.|.||.
plant   145 LTFSLLFTVYATIVDPKKGSLDGFGPLLTGFVVGANILAGGAFSGASMNPARSFGPALVSGNWTD 209

  Fly   209 HWVYWVGPIAGGLLAGIIY 227
            ||||||||:.||.|||.||
plant   210 HWVYWVGPLIGGGLAGFIY 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 83/212 (39%)
TIP4;1NP_180152.1 MIP 1..234 CDD:350945 85/214 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 148 1.000 Domainoid score I1435
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 150 1.000 Inparanoid score I1713
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.