DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and PIP2;8

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_179277.1 Gene:PIP2;8 / 816186 AraportID:AT2G16850 Length:278 Species:Arabidopsis thaliana


Alignment Length:236 Identity:76/236 - (32%)
Similarity:120/236 - (50%) Gaps:27/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KIW---RMLLGELVGTFFLIFVGVGSTTSGSVPQ-----------IAFTFGLTVATIAQGLGHLS 71
            |:|   |.::.|.:.|...::|.| :|..|...|           ||:.||..:..:......:|
plant    30 KLWSFYRAIIAEFIATLLFLYVTV-ATVIGHKNQTGPCGGVGLLGIAWAFGGMIFVLVYCTAGIS 93

  Fly    72 GCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGV---AGGDLGVSSFDPSL 133
            |.|||||||.|..:..::|:.:|..|::.||:|||.|..::|..:...   .||  |.::.....
plant    94 GGHINPAVTFGLFLARKVSLPRAVAYMVAQCLGAICGVGLVKAFMMTPYKRLGG--GANTVADGY 156

  Fly   134 NCAQAVLIEALITFILVFVVKAVSDPGR----QDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPA 194
            :...|:..|.:.||:||:.|.:.:||.|    ..:...|||.:|.|:...||..|.::|..:|||
plant   157 STGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPA 221

  Fly   195 RSFGPAVV---QGVWTYHWVYWVGPIAGGLLAGIIYRLIFK 232
            ||||.||:   :..|..||::||||..|.|.|...::.|.:
plant   222 RSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 74/227 (33%)
PIP2;8NP_179277.1 MIP 28..257 CDD:395174 75/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm1071
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.690

Return to query results.
Submit another query.