DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and Aqp9

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_075249.1 Gene:Aqp9 / 65054 RGDID:68433 Length:295 Species:Rattus norvegicus


Alignment Length:249 Identity:72/249 - (28%)
Similarity:110/249 - (44%) Gaps:37/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KIWRMLLGELVGTFFLIFVGVGSTTS--------GSVPQIAFTFGLTVATIAQGLGHLSGCHINP 77
            :|.:..|.|.:|||.:|.:|..|...        |.:..|...|...|.........:||.||||
  Rat    21 RIAKETLSEFLGTFIMIVLGCSSIAQAVLSRERFGGIITINIGFASAVVMALYVTFGISGGHINP 85

  Fly    78 AVTLGFLIVGEISILKAAFYIIVQCVGAIAGAA-VIKVALDGV---AGGDL-----GVSSF---- 129
            ||:......|.:...|..||:..|.:||..||| |..:..||:   |||.|     ..::|    
  Rat    86 AVSFAMCAFGRMEWFKFPFYVGAQFLGAFVGAATVFGIYYDGLMAFAGGKLLVVGENATAFIFAT 150

  Fly   130 --DPSLNCAQAVLIEALITFILVFVVKAVSDPGRQDI-KGSAPLAVGLAIAAGHLCAIKL-SGAS 190
              .|.::...|.:.:.:.|..|:.:|.|:.|.....: :|..|:.:||.|.. ..|::.| ||.:
  Rat   151 YPAPFISTPGAFVDQVVSTMFLLLIVFAMFDSRNLGVPRGLEPVVIGLLIIV-LSCSLGLNSGCA 214

  Fly   191 MNPARSFGPAVVQGV--W---------TYHWVYWVGPIAGGLLAGIIYRLIFKL 233
            |||||...|.:...:  |         .:.|:..|||:.|..|.|:||.|..::
  Rat   215 MNPARDLSPRLFTALAGWGFEVFTVGNNFWWIPVVGPMIGAFLGGLIYILFIQM 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 68/239 (28%)
Aqp9NP_075249.1 MIP 4..266 CDD:412216 72/245 (29%)
NPA 1. /evidence=ECO:0000250|UniProtKB:Q96PS8 84..86 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:Q96PS8 216..218 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334468
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.