DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and Aqp9

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001258772.1 Gene:Aqp9 / 64008 MGIID:1891066 Length:321 Species:Mus musculus


Alignment Length:235 Identity:65/235 - (27%)
Similarity:103/235 - (43%) Gaps:37/235 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FLIFVGVGSTT--------SGSVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISI 91
            |.:.:|.||..        :|.:..|...|...|.........:||.||||||:......|.:..
Mouse    61 FYLVLGCGSIAQAVLSREKAGGIITINIGFATAVVMALYATFGVSGGHINPAVSFAMCTFGRMEW 125

  Fly    92 LKAAFYIIVQCVGAIAGAA-VIKVALDGV---AGGDLGVSSFD-----------PSLNCAQAVLI 141
            .|..||:..|.:||..||| |..:..||:   |.|.|.::..:           |.::...|.:.
Mouse   126 FKFPFYVGAQLLGAFVGAATVFGIYYDGLMAFADGKLLITGENGTAFIFATYPKPFVSVPGAFVD 190

  Fly   142 EALITFILVFVVKAVSDPGRQDI-KGSAPLAVGLAIAAGHLCAIKL-SGASMNPARSFGPAVVQG 204
            :.:.|..|:.:|.|:.|.....: :|..|:.:||.|.. ..|::.| ||.:|||||...|.:...
Mouse   191 QVVSTMFLLLIVFAIFDSRNLGVPRGLEPIVIGLLIIV-ISCSLGLNSGCAMNPARDLSPRLFTA 254

  Fly   205 V--W---------TYHWVYWVGPIAGGLLAGIIYRLIFKL 233
            :  |         .:.|:..|||:.|.:|.|:||.|..::
Mouse   255 LAGWGFEVFTFGNNFWWIPVVGPMIGAVLGGLIYVLFIQM 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 62/227 (27%)
Aqp9NP_001258772.1 MIP <61..292 CDD:294134 65/231 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830756
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.