DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and aqp9a

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001028268.1 Gene:aqp9a / 606660 ZFINID:ZDB-GENE-050809-119 Length:294 Species:Danio rerio


Alignment Length:259 Identity:74/259 - (28%)
Similarity:121/259 - (46%) Gaps:55/259 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KKIWRMLLGELVGTFFLIFVGVGSTTSGSVPQ----------IAFTFGLTVATIAQGLGHLSGCH 74
            :::::..|.|.:|||.|:..|.||.....:.:          |.|:.||.:.....  |.:||.|
Zfish     9 QRLFKEFLAEFLGTFVLVLFGCGSVAQTVLSRNTLGEPLTIHIGFSTGLMMGVYVS--GGVSGGH 71

  Fly    75 INPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVI--------------KVALDGV-AGGDL 124
            :||||:|..:|:|::.|.|...|:|.|.:||.||||.:              .:::.|: |.|.:
Zfish    72 LNPAVSLAMVILGKLKIWKFPVYVIAQMLGAFAGAAAVFGLYYDAFMEFTSGILSVTGINATGHI 136

  Fly   125 GVSSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGRQ--DIKGSAPLAV-----GLAIAAGHLC 182
            ..|.....|......:.:.:.|.:||..:.|:.| ||.  ..:|..||||     |::::.|..|
Zfish   137 FSSYPGRHLTVLGGFVDQVVGTGMLVLCILAIVD-GRNIGAPRGVEPLAVGVVLLGISVSMGLNC 200

  Fly   183 AIKLSGASMNPARSFGPAVVQGV--W--------TYHWVYWV---GPIAGGLLAGIIYRLIFKL 233
                 |..:||||..||.:...:  |        .|.|  |:   ||:.||::..:||.|:.:|
Zfish   201 -----GYPLNPARDLGPRLFTALAGWGMEVFSTADYWW--WIPVAGPLVGGVVGAVIYFLLIEL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 70/248 (28%)
aqp9aNP_001028268.1 MIP 11..255 CDD:294134 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.