DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and mipb

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001018356.1 Gene:mipb / 553420 ZFINID:ZDB-GENE-050706-86 Length:263 Species:Danio rerio


Alignment Length:243 Identity:97/243 - (39%)
Similarity:136/243 - (55%) Gaps:19/243 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 WRMLLGELVGTFFLIFVGVGST---TSG--SVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLG 82
            ||.:..|..||.|.:|.|:|:.   |:|  .|...|..||...||:.|.:||:||.|||||||..
Zfish    10 WRAVFAEFFGTMFFVFFGMGAALRWTTGPYHVFHTALCFGFAAATLIQSIGHISGGHINPAVTFA 74

  Fly    83 FLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVA----GGDLGVSSFDPSLNCAQAVLIEA 143
            :|:..::|:.:|.|||..||:||:||||    ||.||.    .|.:.:::..|.::...|..:|.
Zfish    75 YLVGSQMSVFRAFFYICAQCLGAMAGAA----ALYGVTPNNMRGTMALNTLQPGMSLGMATTVEV 135

  Fly   144 LITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTY 208
            .:|..||..|.||:|..|....|||.|::|.::..|||..:..:||.|||||||.|||:...:..
Zfish   136 FLTMQLVVCVFAVTDERRNGRLGSAALSIGFSVTMGHLMGMYYTGAGMNPARSFAPAVITRNFIN 200

  Fly   209 HWVYWVGPIAGGLLAGIIYR-LIFKLKKGCTPFQGHESLWSLDALRIP 255
            ||||||||:.|..:..|.|. .:|...:|.:     |.|.:|...|.|
Zfish   201 HWVYWVGPMIGAAMGAIFYDFFLFPRMRGFS-----ERLATLKGSRPP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 89/212 (42%)
mipbNP_001018356.1 MIP 3..219 CDD:294134 89/212 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.