DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and aqp3

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001016845.1 Gene:aqp3 / 549599 XenbaseID:XB-GENE-488014 Length:294 Species:Xenopus tropicalis


Alignment Length:261 Identity:74/261 - (28%)
Similarity:107/261 - (40%) Gaps:39/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KIWRMLLGELVGTFFLIFVGVGST-----TSGSVPQ-----IAFTFGLTVATIAQGLGHLSGCHI 75
            |:.|..|.|.:||..|:..|.||.     :.||..|     :||.|.:.:..:..  |.:||.|:
 Frog    20 KLLRQALSECLGTLILVMFGCGSVAQVVLSKGSHGQFLTVNLAFGFAVMLGILIS--GQVSGGHL 82

  Fly    76 NPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVI-KVALDGV------------AGGDLGVS 127
            |||||....|:.....:|...|...|.:||..||.:| .:..|.:            ..|..|:.
 Frog    83 NPAVTFALCIMAREPWIKFPIYSFAQTLGAFLGAGIIYGLYYDAIWFFGNDQLFVMGENGTAGIF 147

  Fly   128 SFDPS--LNCAQAVLIEALITFILVFVVKAVSDPGRQDI-KGSAPLAVGLAIAAGHLCAIKLSGA 189
            :..||  |........:.:.|..|:..|.|:.||....| :|.....||..:..........||.
 Frog   148 TTFPSEHLTLINGFFDQFIGTAALIVCVLAIVDPNNNPIPRGLEAFTVGFVVLVIGTSMGFNSGY 212

  Fly   190 SMNPARSFGPAVVQGV--WTYHWVYWVG------PIAGGLLAGIIYRLIFKLKKGC--TPFQGHE 244
            ::||||.|||.:...:  |... |:|.|      ||...||......|:::|..||  .|.|..:
 Frog   213 AVNPARDFGPRLFTSLAGWGTE-VFWAGNQWWWVPIVSPLLGAFTGVLVYQLMIGCHIEPAQTPQ 276

  Fly   245 S 245
            |
 Frog   277 S 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 66/237 (28%)
aqp3NP_001016845.1 MIP 24..264 CDD:238204 66/242 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.