DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and aqp2

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001015749.1 Gene:aqp2 / 548466 XenbaseID:XB-GENE-481401 Length:273 Species:Xenopus tropicalis


Alignment Length:216 Identity:101/216 - (46%)
Similarity:136/216 - (62%) Gaps:12/216 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RMLLGELVGTFFLIFVGVGSTTS--GSVP---QIAFTFGLTVATIAQGLGHLSGCHINPAVTLGF 83
            |.:..|.:.|...:|:|:||..|  .|:|   ||:..|||.::|:.|..||:||.|||||||:.|
 Frog    12 RAVFAEFLATMIFVFLGMGSALSWKPSLPNVLQISLAFGLAISTLVQAFGHISGAHINPAVTIAF 76

  Fly    84 LIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLG---VSSFDPSLNCAQAVLIEALI 145
            ||...||.|:|.||||.|.||||||||::.......|.|:|.   |::..|...||    :|..:
 Frog    77 LIGCHISFLRALFYIIAQLVGAIAGAAIVSAIAPLDARGNLAINEVTNGSPGQACA----VELFL 137

  Fly   146 TFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTYHW 210
            ||.||..|.|.:|..|.|..||..:::||::..|||..|.|:|.|||||||||||.:.|::|.||
 Frog   138 TFQLVLCVFASTDSRRSDNVGSPAISIGLSVTVGHLLGIYLTGCSMNPARSFGPAAITGIFTDHW 202

  Fly   211 VYWVGPIAGGLLAGIIYRLIF 231
            |:|:||:.||:||.:.|..||
 Frog   203 VFWIGPLVGGILASLFYNYIF 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 98/210 (47%)
aqp2NP_001015749.1 MIP 4..219 CDD:333943 98/210 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.