DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and aqp1

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001005829.1 Gene:aqp1 / 448309 XenbaseID:XB-GENE-1217296 Length:274 Species:Xenopus tropicalis


Alignment Length:237 Identity:95/237 - (40%)
Similarity:140/237 - (59%) Gaps:19/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VADITENKKIWRMLLGELVGTFFLIFVGVGS-------------------TTSGSVPQIAFTFGL 58
            :|...:.|..||.::.|.:.....:|:.:|:                   |....:.:::..|||
 Frog     1 MASELKKKAFWRAVIAEFLAMILFVFISIGAALGVQYPIPADAANATNTDTRQQDIVKVSLAFGL 65

  Fly    59 TVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGD 123
            .:||:||.:||:||.|:|||||||.|:..:||||||..|||.||:||:.|.|::......::...
 Frog    66 AIATLAQSVGHISGAHLNPAVTLGCLLSCQISILKALMYIIAQCLGAVVGTAILSGITTQISNNS 130

  Fly   124 LGVSSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSG 188
            ||::.....::..|.:.:|.::||.||..|.|::|..|.|:.||||||:||::|.|||.||..:|
 Frog   131 LGLNGLSNGVSQGQGLGVEIMVTFQLVLCVVAITDRRRNDVSGSAPLAIGLSVALGHLIAIDYTG 195

  Fly   189 ASMNPARSFGPAVVQGVWTYHWVYWVGPIAGGLLAGIIYRLI 230
            ..||||||||.|||...:..||::||||:.||..|.|||..|
 Frog   196 CGMNPARSFGSAVVAKQFANHWIFWVGPMIGGAAAAIIYDFI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 90/222 (41%)
aqp1NP_001005829.1 MIP 4..234 CDD:333943 91/229 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm48599
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.