DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and aqp8a.1

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001004661.1 Gene:aqp8a.1 / 447923 ZFINID:ZDB-GENE-040912-106 Length:260 Species:Danio rerio


Alignment Length:217 Identity:82/217 - (37%)
Similarity:118/217 - (54%) Gaps:10/217 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LGELVGTFFLIFVGVGST-----TSGSVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIV 86
            |.|:||:|..:|||..|.     .|||: |.|...||.:|......|.:||.|.||||::...::
Zfish    40 LAEVVGSFLFMFVGCVSVMGNVGISGSI-QPALAHGLALAIAIAIFGEISGGHFNPAVSVCVYLI 103

  Fly    87 GEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFD--PSLN-CAQAVLIEALITFI 148
            |.:.::....|||.|.:|.:..|::.|......|..:...::|:  ||.: ...|.:.|.::|..
Zfish   104 GGMEVILLVPYIISQMLGGVIAASLAKAVTTNDAFSNATGAAFNAIPSSDGIGAATMAEMIMTLF 168

  Fly   149 LVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTYHWVYW 213
            |..||...:..||...: .||..:||.:.|..|....:|||.|||||:||||||.|.||:||:||
Zfish   169 LTIVVSMGAVNGRTKSQ-LAPFCIGLTVTANILAGGGISGACMNPARAFGPAVVSGHWTHHWIYW 232

  Fly   214 VGPIAGGLLAGIIYRLIFKLKK 235
            |||:.|.|:...|.||:...||
Zfish   233 VGPLTGALVTVSIVRLVMGDKK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 77/207 (37%)
aqp8a.1NP_001004661.1 MIP 39..249 CDD:294134 79/210 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.