DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and aqp4

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001345242.1 Gene:aqp4 / 445293 ZFINID:ZDB-GENE-040724-152 Length:346 Species:Danio rerio


Alignment Length:255 Identity:107/255 - (41%)
Similarity:152/255 - (59%) Gaps:24/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MSKFVGVADITENKKIWRMLLGELVGTFFLIFVGVGSTTSGSVPQ----------IAFTFGLTVA 61
            |:.|.||    ..::.||.:.||.:.....:.:.:|||.:....|          |:..|||::|
Zfish    24 MAAFKGV----WTQEFWRAVSGEFLAMIIFVLLSLGSTINWGAKQENPPPADLVLISLCFGLSIA 84

  Fly    62 TIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGV 126
            |:.|..||:||.|||||||:..:...::|:.|..||::.||:||:.|||::.........|.:||
Zfish    85 TLVQCFGHISGAHINPAVTVAMVATRKLSLAKGVFYLLAQCLGAVVGAAILYGVTPASVRGGMGV 149

  Fly   127 SSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASM 191
            :|.:..::...|::||.:|||.|||.|.|..||.|.|:||||.||:||::..|||.||..:||||
Zfish   150 TSVNEEISAGHAIVIELIITFELVFTVFATCDPKRNDLKGSAALAIGLSVCIGHLFAIPYTGASM 214

  Fly   192 NPARSFGPAVVQGVWTYHWVYWVGPIAGGLLAGIIYRLIF----KLKK------GCTPFQ 241
            ||||||||||:...|..||||||||:.||:||..:|..:|    .||:      ..:|||
Zfish   215 NPARSFGPAVIMVKWQDHWVYWVGPLIGGILAAAVYEYLFCPDPDLKRRYADVLSKSPFQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 96/213 (45%)
aqp4NP_001345242.1 MIP 32..250 CDD:278651 96/217 (44%)
DUF737 <290..>345 CDD:310129
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 206 1.000 Domainoid score I2854
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37507
Inparanoid 1 1.050 208 1.000 Inparanoid score I3663
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm25039
orthoMCL 1 0.900 - - OOG6_100198
Panther 1 1.100 - - LDO PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.