DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and mipa

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001003534.1 Gene:mipa / 445140 ZFINID:ZDB-GENE-040801-41 Length:263 Species:Danio rerio


Alignment Length:220 Identity:94/220 - (42%)
Similarity:134/220 - (60%) Gaps:6/220 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 WRMLLGELVGTFFLIFVGVGST---TSG--SVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLG 82
            ||.:..|..||.|.:|.|:|:.   |:|  :|.|:||.|||..||..|.:||:||.|||||||..
Zfish    10 WRAVFAEFYGTMFFVFFGLGAALRWTTGPHNVLQVAFCFGLAAATFIQSIGHISGGHINPAVTFA 74

  Fly    83 FLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNCAQAVLIEALITF 147
            :||..::|:.:|.|||..||:||:|||||:.........|:|.:::..|.::...|..||..:|.
Zfish    75 YLIGSQMSLFRAFFYICAQCLGALAGAAVLYGVTPTNMRGNLALNTLQPGISMGMATTIEIFLTL 139

  Fly   148 ILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTYHWVY 212
            .||..|.||:|..|....|||.|::|.::..|||..:..:||.|||||||.|||:...:..||||
Zfish   140 QLVVCVFAVTDERRNGRLGSAALSIGFSVLVGHLLGMYYTGAGMNPARSFAPAVLYRNFINHWVY 204

  Fly   213 WVGPIAGGLLAGIIYR-LIFKLKKG 236
            ||||:.|..:..::|. ::|...:|
Zfish   205 WVGPMIGAAMGALLYDFMLFPRVRG 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 91/208 (44%)
mipaNP_001003534.1 MIP 3..219 CDD:278651 91/208 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 206 1.000 Domainoid score I2854
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm25039
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.