DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and aqp3a

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_998633.1 Gene:aqp3a / 406777 ZFINID:ZDB-GENE-040426-2826 Length:296 Species:Danio rerio


Alignment Length:275 Identity:74/275 - (26%)
Similarity:114/275 - (41%) Gaps:59/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EKTEMSKFVGVADITENKKIWRMLLGELVGTFFLIFVGVGS-----TTSGS-----VPQIAFTFG 57
            :|:.:.|......|  ..|:.|..|.|.:||..|:..|.||     .:.||     ...:||.||
Zfish     4 QKSVLDKLAQTFQI--RNKLLRQGLAECLGTLILVMFGCGSLAQLKLSEGSHGLFLTANLAFGFG 66

  Fly    58 LTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKV----ALDG 118
            .|:..:.  .|.:||.|:|||||....::|.....|...|.:.|.:|:..|||:|..    |:..
Zfish    67 ATLGILV--CGQVSGGHLNPAVTFALCLLGREKWRKFPVYFLFQTLGSFLGAAIIFAEYHDAIYD 129

  Fly   119 VAG--------GD---LGVSSFDPS--LNCAQAVLIEALITFILVFVVKAVSDPGRQDIK----- 165
            .||        |:   .|:.:..||  |........:.:.|..|:..:.|:.||....|.     
Zfish   130 YAGESNELLVLGEKETAGIFATYPSKYLTPLNGFFDQVIGTASLIVCILAIVDPYNNPIPQGLEA 194

  Fly   166 ---GSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQG-------VWTYHWVYW-----VG 215
               |.:.|.:||::...       ||.::||||.|||.:...       |:|.. .||     ..
Zfish   195 FTVGFSVLIIGLSMGFN-------SGYAVNPARDFGPRLFTAMAGWGSEVFTAR-DYWFLVPIFA 251

  Fly   216 PIAGGLLAGIIYRLI 230
            |..|.::..|:|:|:
Zfish   252 PFIGAVIGVIVYQLM 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 68/250 (27%)
aqp3aNP_998633.1 MIP 23..266 CDD:238204 69/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.