DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and Eglp3

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster


Alignment Length:235 Identity:83/235 - (35%)
Similarity:115/235 - (48%) Gaps:29/235 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 WRM----------LLGELVGTFFLIFVGVGSTTSGSVPQIAF---------TFGLTVATIAQGLG 68
            ||:          ..|||..|...:|:    ...|.|....|         ||||.:....|..|
  Fly    17 WRLEGHQRSAIACFFGELAATAVFVFI----ACMGCVETPLFQNSHFRSGLTFGLAILIAIQCFG 77

  Fly    69 HLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDG--VAGGD----LGVS 127
            .:||.|:|||:||...:.|.|..::|..|.:.|..||:.|..::...|.|  :.|.|    :.|:
  Fly    78 SVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVCVT 142

  Fly   128 SFDPSLNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMN 192
            ...|.::..|.|.||.|||..||.|..:|.||....::.|.|:..||.::...|.|...:|||||
  Fly   143 ILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMN 207

  Fly   193 PARSFGPAVVQGVWTYHWVYWVGPIAGGLLAGIIYRLIFK 232
            |.||.||||....|.:||:|||||:..|.:..:|||:.||
  Fly   208 PTRSLGPAVWNDSWAHHWIYWVGPLVAGAVTSLIYRMAFK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 78/228 (34%)
Eglp3NP_611812.2 MIP 30..244 CDD:294134 78/217 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438270
Domainoid 1 1.000 121 1.000 Domainoid score I3512
eggNOG 1 0.900 - - E1_COG0580
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I3275
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm51414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.