DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and Eglp2

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster


Alignment Length:223 Identity:83/223 - (37%)
Similarity:116/223 - (52%) Gaps:21/223 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLGELVGTFFLIFVGVGSTTSGSV-----PQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLI 85
            :|.|::.|..|:|:|...:...||     .|.|..||..|....|..|.:.|.|:||||||...:
  Fly    49 VLAEMIATAMLMFLGCMGSVENSVFTNSDFQSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYV 113

  Fly    86 VGEISILKAAFYIIVQCVGAIAGAAVIKVAL-----------DGVAGGDLGVSSFDPSLNCAQAV 139
            ...||:..|..|.:.|.|||..|..::|..|           :||.     ::|.:.:|...|.:
  Fly   114 YNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVC-----LTSLNSTLTPWQGL 173

  Fly   140 LIEALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQG 204
            .:|.|||.:|:.|...|.||.....:.|.|:..|||||...|.|.:|:||||||.|||.||:..|
  Fly   174 AVEFLITCVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPAIWNG 238

  Fly   205 VWTYHWVYWVGPIAGGLLAGIIYRLIFK 232
            .|..||:|||||:|..|:..:||:..|:
  Fly   239 FWDDHWIYWVGPMAAALITSVIYKHAFR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 80/216 (37%)
Eglp2NP_788433.2 MIP 41..261 CDD:294134 80/216 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438269
Domainoid 1 1.000 121 1.000 Domainoid score I3512
eggNOG 1 0.900 - - E1_COG0580
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I1546
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm51414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.