DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and AQP7

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001161.1 Gene:AQP7 / 364 HGNCID:640 Length:342 Species:Homo sapiens


Alignment Length:269 Identity:71/269 - (26%)
Similarity:116/269 - (43%) Gaps:46/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TEMSKFVG---VADITE--NKKIWRMLLGELVGTFFLIFVGVGSTTS-------GSVPQIAFTFG 57
            |..||.|.   :|.|.|  .:|:.|..|.|.:.|:.::..|:||...       ||...:...||
Human    11 TRGSKMVSWSVIAKIQEILQRKMVREFLAEFMSTYVMMVFGLGSVAHMVLNKKYGSYLGVNLGFG 75

  Fly    58 LTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVI----KVALDG 118
            ..|.......|.:||.|:|.|||.....:|.:...|...|::.|.:|:...||.|    ..|:..
Human    76 FGVTMGVHVAGRISGAHMNAAVTFANCALGRVPWRKFPVYVLGQFLGSFLAAATIYSLFYTAILH 140

  Fly   119 VAGGDLGV----------SSFDPS-LNCAQAVLIEALITFILVFVVKAVSD-PGRQDIKGSAPLA 171
            .:||.|.|          :::.|. :...:..|.||.:|.:|...:.|::| .....:.|:..|.
Human   141 FSGGQLMVTGPVATAGIFATYLPDHMTLWRGFLNEAWLTGMLQLCLFAITDQENNPALPGTEALV 205

  Fly   172 VGLAIAAGHLCAIKL---SGASMNPARSFGPAVVQGV--W---------TYHWVYWVGPIAGGLL 222
            :|:.:.   :..:.|   :|.::||:|...|.:...:  |         .:.||..|.|:.|..|
Human   206 IGILVV---IIGVSLGMNTGYAINPSRDLPPRIFTFIAGWGKQVFSNGENWWWVPVVAPLLGAYL 267

  Fly   223 AGIIYRLIF 231
            .|||| |:|
Human   268 GGIIY-LVF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 59/240 (25%)
AQP7NP_001161.1 MIP 31..280 CDD:412216 64/249 (26%)
NPA 1. /evidence=ECO:0000250|UniProtKB:P55064 94..96 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:P55064 226..228 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.