DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and AQP6

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001643.2 Gene:AQP6 / 363 HGNCID:639 Length:282 Species:Homo sapiens


Alignment Length:220 Identity:100/220 - (45%)
Similarity:126/220 - (57%) Gaps:15/220 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KKIWRMLLGELVGTFFLIFVGVGS-----TTSGSVPQIAFTFGLTVATIAQGLGHLSGCHINPAV 79
            |.|.|.|..|.:.|...:|.||||     |...||.|||.||.|..|...|.....||.|.||||
Human    21 KAISRALFAEFLATGLYVFFGVGSVMRWPTALPSVLQIAITFNLVTAMAVQVTWKASGAHANPAV 85

  Fly    80 TLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGD----LGVSSFDPSLNCAQAVL 140
            ||.||:...||:.:|..|:..|.|||..|||:    |.||..||    ||::....|::..|||.
Human    86 TLAFLVGSHISLPRAVAYVAAQLVGATVGAAL----LYGVMPGDIRETLGINVVRNSVSTGQAVA 146

  Fly   141 IEALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGV 205
            :|.|:|..||..|.|.:| .|| ..||....:|:::|.|||..|..:|.|||||||||||::.|.
Human   147 VELLLTLQLVLCVFASTD-SRQ-TSGSPATMIGISVALGHLIGIHFTGCSMNPARSFGPAIIIGK 209

  Fly   206 WTYHWVYWVGPIAGGLLAGIIYRLI 230
            :|.|||:||||:.|.|||.:||..:
Human   210 FTVHWVFWVGPLMGALLASLIYNFV 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 96/212 (45%)
AQP6NP_001643.2 MIP 25..231 CDD:294134 96/211 (45%)
NPA 1 82..84 1/1 (100%)
NPA 2 196..198 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140805
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.