DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and Prip

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster


Alignment Length:262 Identity:99/262 - (37%)
Similarity:147/262 - (56%) Gaps:34/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MSKF---VGVADI-TENKKIWRMLLGELVGTFFLIFVGVGSTTSGSVPQI------AFTFGLTVA 61
            |.||   :|:.:: ::..::|:.|:||.:|...|.|...|:.|     ||      |..|||.:.
  Fly     1 MGKFEYSLGLNELKSKELRLWQALIGEFLGNLILNFFACGACT-----QIEDGTFKALAFGLAIF 60

  Fly    62 TIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGV 126
            .....:|||||.|:|||||.|.|:.|.||:::|.||::.||:|||||.|.:|:.:|......||.
  Fly    61 MAITIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGH 125

  Fly   127 SSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASM 191
            :|..|::...|.:.||..:..:||.||....||.:.|.:.:||||:|:|:..|||..|:.:||||
  Fly   126 TSLAPNITELQGLGIEFFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASM 190

  Fly   192 NPARSFGPAVVQGVWTYHWVYWVGPIAGGLLAGIIYRLIFKLK-------------------KGC 237
            ||||:.|.|....:|..||||||||:.||:.|.::|..:.:.|                   :||
  Fly   191 NPARTVGTAFATDIWASHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKYRTHADEREGC 255

  Fly   238 TP 239
            .|
  Fly   256 KP 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 90/209 (43%)
PripNP_001246266.1 MIP 12..226 CDD:294134 90/218 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I3512
eggNOG 1 0.900 - - E1_COG0580
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I3275
Isobase 1 0.950 - 0.831874 Normalized mean entropy S1947
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D101390at50557
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm51414
orthoMCL 1 0.900 - - OOG6_100198
Panther 1 1.100 - - P PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
1312.860

Return to query results.
Submit another query.