DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and AQP5

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001642.1 Gene:AQP5 / 362 HGNCID:638 Length:265 Species:Homo sapiens


Alignment Length:210 Identity:91/210 - (43%)
Similarity:131/210 - (62%) Gaps:6/210 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RMLLGELVGTFFLIFVGVGSTTS--GSVP---QIAFTFGLTVATIAQGLGHLSGCHINPAVTLGF 83
            :.:..|.:.|...:|.|:||...  .::|   |||..|||.:.|:||.||.:||.|||||:||..
Human    12 KAVFAEFLATLIFVFFGLGSALKWPSALPTILQIALAFGLAIGTLAQALGPVSGGHINPAITLAL 76

  Fly    84 LIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNCAQAVLIEALITFI 148
            |:..:||:|:|.||:..|.|||||||.::.......|.|:|.|::.:.:....||:::|.::||.
Human    77 LVGNQISLLRAFFYVAAQLVGAIAGAGILYGVAPLNARGNLAVNALNNNTTQGQAMVVELILTFQ 141

  Fly   149 LVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWT-YHWVY 212
            |...:.|.:|..|....||..|::||::..|||..|..:|.|||||||||||||...:: .|||:
Human   142 LALCIFASTDSRRTSPVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFSPAHWVF 206

  Fly   213 WVGPIAGGLLAGIIY 227
            |||||.|.:||.|:|
Human   207 WVGPIVGAVLAAILY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 90/208 (43%)
AQP5NP_001642.1 MIP 4..221 CDD:395174 90/208 (43%)
NPA 1. /evidence=ECO:0000305|PubMed:18768791, ECO:0000305|PubMed:26569106 69..71 1/1 (100%)
NPA 2. /evidence=ECO:0000305|PubMed:18768791, ECO:0000305|PubMed:26569106 185..187 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140770
Domainoid 1 1.000 190 1.000 Domainoid score I3263
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I3838
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm41396
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.