DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and AQP4

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001304313.1 Gene:AQP4 / 361 HGNCID:637 Length:352 Species:Homo sapiens


Alignment Length:234 Identity:101/234 - (43%)
Similarity:138/234 - (58%) Gaps:13/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MSKFVGVADITENKKIWRMLLGELVGTFFLIFVGVGST-----TSGSVP----QIAFTFGLTVAT 62
            |..|.||    ..:..|:.:..|.:.....:.:.:|||     |...:|    .|:..|||::||
Human    23 MVAFKGV----WTQAFWKAVTAEFLAMLIFVLLSLGSTINWGGTEKPLPVDMVLISLCFGLSIAT 83

  Fly    63 IAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVS 127
            :.|..||:||.|||||||:..:...:|||.|:.|||..||:|||.||.::.:.......|.|||:
Human    84 MVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIAAQCLGAIIGAGILYLVTPPSVVGGLGVT 148

  Fly   128 SFDPSLNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMN 192
            ....:|.....:|:|.:|||.|||.:.|..|..|.|:.||..||:|.::|.|||.||..:|||||
Human   149 MVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIGHLFAINYTGASMN 213

  Fly   193 PARSFGPAVVQGVWTYHWVYWVGPIAGGLLAGIIYRLIF 231
            |||||||||:.|.|..||:||||||.|.:|||.:|..:|
Human   214 PARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVF 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 95/212 (45%)
AQP4NP_001304313.1 MIP 31..248 CDD:278651 95/216 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 190 1.000 Domainoid score I3263
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37507
Inparanoid 1 1.050 194 1.000 Inparanoid score I3838
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm41396
orthoMCL 1 0.900 - - OOG6_100198
Panther 1 1.100 - - LDO PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.