DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and AQP3

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_004916.1 Gene:AQP3 / 360 HGNCID:636 Length:292 Species:Homo sapiens


Alignment Length:251 Identity:70/251 - (27%)
Similarity:103/251 - (41%) Gaps:37/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KIWRMLLGELVGTFFLIFVGVGST--------TSGSVPQIAFTFGLTVATIAQGLGHLSGCHINP 77
            ::.|..|.|.:||..|:..|.||.        |.|....|...||..|.......|.:||.|:||
Human    20 RLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGILIAGQVSGAHLNP 84

  Fly    78 AVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVI--------------KVALDGVAGGDLGVSS 128
            |||.....:.....:|...|.:.|.:||..||.::              ::.:.| ..|..|:.:
Human    85 AVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGLYYDAIWHFADNQLFVSG-PNGTAGIFA 148

  Fly   129 FDPS--LNCAQAVLIEALITFILVFVVKAVSDPGRQDI-KGSAPLAVGLAIAAGHLCAIKLSGAS 190
            ..||  |:.......:.:.|..|:..|.|:.||....: :|.....|||.:..........||.:
Human   149 TYPSGHLDMINGFFDQFIGTASLIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYA 213

  Fly   191 MNPARSFGPAVV-------QGVWT--YHWVYWVGPIAGGLLAGIIYRLIFKLKKGC 237
            :||||.|||.:.       ..|:|  .|| :|| ||...||..|....:::|..||
Human   214 VNPARDFGPRLFTALAGWGSAVFTTGQHW-WWV-PIVSPLLGSIAGVFVYQLMIGC 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 67/237 (28%)
AQP3NP_004916.1 MIP 23..264 CDD:238204 67/243 (28%)
NPA 1. /evidence=ECO:0000250|UniProtKB:Q96PS8 83..85 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:Q96PS8 215..217 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.