DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and AQP2

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_000477.1 Gene:AQP2 / 359 HGNCID:634 Length:271 Species:Homo sapiens


Alignment Length:212 Identity:88/212 - (41%)
Similarity:127/212 - (59%) Gaps:5/212 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RMLLGELVGTFFLIFVGVGSTTS-----GSVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGF 83
            |.:..|.:.|...:|.|:||..:     .||.|||..|||.:.|:.|.|||:||.|||||||:..
Human    11 RAVFAEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGLGIGTLVQALGHISGAHINPAVTVAC 75

  Fly    84 LIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNCAQAVLIEALITFI 148
            |:...:|:|:||||:..|.:||:||||::.........|||.|::...|....|||.:|..:|..
Human    76 LVGCHVSVLRAAFYVAAQLLGAVAGAALLHEITPADIRGDLAVNALSNSTTAGQAVTVELFLTLQ 140

  Fly   149 LVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTYHWVYW 213
            ||..:.|.:|..|.:..|:..|::|.::|.|||..|..:|.|||||||..||||.|.:..|||:|
Human   141 LVLCIFASTDERRGENPGTPALSIGFSVALGHLLGIHYTGCSMNPARSLAPAVVTGKFDDHWVFW 205

  Fly   214 VGPIAGGLLAGIIYRLI 230
            :||:.|.:|..::|..:
Human   206 IGPLVGAILGSLLYNYV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 87/207 (42%)
AQP2NP_000477.1 MIP 3..219 CDD:278651 87/207 (42%)
NPA 1. /evidence=ECO:0000305|PubMed:24733887 68..70 1/1 (100%)
NPA 2. /evidence=ECO:0000305|PubMed:24733887 184..186 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140761
Domainoid 1 1.000 190 1.000 Domainoid score I3263
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I3838
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm41396
orthoMCL 1 0.900 - - OOG6_100198
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.