DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and AQP1

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001316801.1 Gene:AQP1 / 358 HGNCID:633 Length:323 Species:Homo sapiens


Alignment Length:225 Identity:95/225 - (42%)
Similarity:135/225 - (60%) Gaps:12/225 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ENKKIWRMLLGELVGTFFLIFVGVGSTTSGSVP------------QIAFTFGLTVATIAQGLGHL 70
            :.|..||.::.|.:.|...:|:.:||......|            :::..|||::||:||.:||:
Human     6 KKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNVKVSLAFGLSIATLAQSVGHI 70

  Fly    71 SGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNC 135
            ||.|:|||||||.|:..:|||.:|..|||.||||||...|::......:.|..||.:.....:|.
Human    71 SGAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLTGNSLGRNDLADGVNS 135

  Fly   136 AQAVLIEALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPA 200
            .|.:.||.:.|..||..|.|.:|..|:|:.||||||:||::|.|||.||..:|..:|||||||.|
Human   136 GQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSA 200

  Fly   201 VVQGVWTYHWVYWVGPIAGGLLAGIIYRLI 230
            |:...::.||::||||..||.||.:||..|
Human   201 VITHNFSNHWIFWVGPFIGGALAVLIYDFI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 91/215 (42%)
AQP1NP_001316801.1 NPA 1 76..78 1/1 (100%)
NPA 2 192..194 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 190 1.000 Domainoid score I3263
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I3838
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm41396
orthoMCL 1 0.900 - - OOG6_100198
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.