DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and aqp-12

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001022480.1 Gene:aqp-12 / 3565789 WormBaseID:WBGene00013272 Length:243 Species:Caenorhabditis elegans


Alignment Length:154 Identity:37/154 - (24%)
Similarity:65/154 - (42%) Gaps:33/154 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LGELVGTFFLIFVGVGSTTSGSVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISI 91
            ||.::.:|...|.|....::..|......|.|.:|...  :.||:..|:|||::|...:..||.:
 Worm    28 LGAVIFSFLACFAGQYQRSNDLVYPFLSAFSLYIARCL--VSHLTPAHLNPAISLLQWLRNEIPL 90

  Fly    92 LKAAFYIIVQCVGAIAGAAVIK-----------------VALDGVAGGDLGVSSFDPSLNCAQAV 139
            :....:..||.:|.:.|..:.:                 ||:||..           .:|..||.
 Worm    91 VLLITFCFVQLIGFLFGVTLFRALVTQTEFNDYIVMYEIVAVDGTR-----------KINRLQAF 144

  Fly   140 LIEALITFILVFVVKAVSDPGRQD 163
            |:|.:::.|. |:..|:.|  ||:
 Worm   145 LLEVVLSMIF-FMANALED--RQE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 37/154 (24%)
aqp-12NP_001022480.1 MIP 24..>155 CDD:294134 32/140 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.