DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and bib

DIOPT Version :10

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster


Alignment Length:33 Identity:9/33 - (27%)
Similarity:14/33 - (42%) Gaps:12/33 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 IHIQADLIVYLQTSPEVVYERMKQRARSEESCV 170
            |:|:..|:|:            ||..||...|:
  Fly   122 INIRRPLVVF------------KQGFRSRNYCL 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:444743 9/33 (27%)
bibNP_001260313.1 MIP 58..273 CDD:395174 9/33 (27%)

Return to query results.
Submit another query.