DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and aqp1a.1

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_996942.1 Gene:aqp1a.1 / 335821 ZFINID:ZDB-GENE-030131-7764 Length:260 Species:Danio rerio


Alignment Length:218 Identity:100/218 - (45%)
Similarity:143/218 - (65%) Gaps:12/218 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ENKKIWRMLLGELVGTFFLIFV----GVGSTTSGSVPQ---IAFTFGLTVATIAQGLGHLSGCHI 75
            ::|..||.:|.||:|....||:    .||:|.:.:..|   :|..|||::||:||.|||:||.|:
Zfish     5 KSKAFWRAVLAELLGMTLFIFLSITAAVGNTNTQNPDQEIKVALAFGLSIATLAQSLGHISGAHL 69

  Fly    76 NPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGD-LGVSSFDPSLNCAQAV 139
            |||||||.|...:||:|:|..||:.|.:||...:|::.    ||:.|| ||::.....::..|.|
Zfish    70 NPAVTLGLLASCQISLLRAVMYILAQMIGATVASAIVL----GVSKGDALGLNQIHTDISAGQGV 130

  Fly   140 LIEALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQG 204
            .||.|.||.||..|.|.:|..|:|:.||||||:||::..|||.||..:|..:||||:||||:::.
Zfish   131 GIELLATFQLVLCVLATTDKRRRDVSGSAPLAIGLSVCLGHLTAISFTGCGINPARTFGPAMIRL 195

  Fly   205 VWTYHWVYWVGPIAGGLLAGIIY 227
            .:..||||||||:.||:.|.:||
Zfish   196 DFANHWVYWVGPMCGGVAAALIY 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 97/211 (46%)
aqp1a.1NP_996942.1 MIP 3..218 CDD:278651 98/216 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 206 1.000 Domainoid score I2854
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm25039
orthoMCL 1 0.900 - - OOG6_100198
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.