DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and aqp7

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_005161068.1 Gene:aqp7 / 334529 ZFINID:ZDB-GENE-030131-6461 Length:310 Species:Danio rerio


Alignment Length:272 Identity:68/272 - (25%)
Similarity:112/272 - (41%) Gaps:49/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MSKFVGVADITENKKIWRMLLGELVGTFFLIFVGVGSTTS--------GSVPQIAFTFGLTVATI 63
            |:..||.....:|:.| |:.|.|.:.||.::..|:|:...        |....|...|||.||..
Zfish    10 MAPNVGSMLKIKNEYI-RVALAESLCTFIMMVFGLGTVAQVVTGEGYFGEYLSINIGFGLAVAMG 73

  Fly    64 AQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGA--------AVIKVALDGV- 119
            ....|.:||.|:|.||:....:.|.:.......|:..|.:|:...|        |.:.:.:|.: 
Zfish    74 VHVGGKVSGAHMNAAVSFTMCVFGRLRWKMLPLYVFAQFLGSFLAAGTIFSLYYAFVLLFIDAIN 138

  Fly   120 --AGGDLGVSSFD-----------PSLNCAQAVLIEALITFILVFVVKAVSDPGRQD-IKGSAPL 170
              .||:|.||...           |.::.......:...|.:|:..:.|:||...|. :.|...:
Zfish   139 HFCGGNLTVSGPKATAGIFATYPAPYISVYTGFFDQVAGTGLLLLCLMALSDQRNQPLVSGGEAV 203

  Fly   171 AVGLAIAAGHLCAIKL---SGASMNPARSFGPAV--VQGVW---------TYHWVYWVGPIAGGL 221
            .|||.:.   |..:.:   ||.::||.|..||.:  :...|         .:.||..|.|..||:
Zfish   204 GVGLLVM---LIGVSMGSNSGYAINPTRDLGPRLFTLMAGWGTEVFRAGNCWWWVPLVAPFIGGV 265

  Fly   222 LAGIIYRLIFKL 233
            |..:||:.:.:|
Zfish   266 LGALIYKALVEL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 60/248 (24%)
aqp7XP_005161068.1 MIP 7..275 CDD:294134 67/268 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.