DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and Aqp7

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_062030.2 Gene:Aqp7 / 29171 RGDID:2145 Length:269 Species:Rattus norvegicus


Alignment Length:258 Identity:67/258 - (25%)
Similarity:109/258 - (42%) Gaps:52/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ITEN-----KKIW-RMLLGELVGTFFLIFVGVGSTTS-------GSVPQIAFTFGLTVATIAQGL 67
            :.||     :|.| |..|.|.:.|:.|:..|:||...       ||...:...||..|.......
  Rat     5 VLENIQSVLQKTWVREFLAEFLSTYVLMVFGLGSVAHMVLGERLGSYLGVNLGFGFGVTMGIHVA 69

  Fly    68 GHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAA----VIKVALDGVAGGDLGVSS 128
            |.:||.|:|.|||.....:|.::..|...|::.|.:|:...||    :...|::..|||:|.|:.
  Rat    70 GGISGAHMNAAVTFTNCALGRMAWKKFPIYVLGQFLGSFLAAATTYLIFYGAINHYAGGELLVTG 134

  Fly   129 FDPSLNCAQAVL-----------IEALITFILVFVVKAVSDP-GRQDIKGSAPLAVGLAIAAGHL 181
            ...:.|.....|           .|..:|.:|...:.|::|. ....::|:.||.:|:.:     
  Rat   135 PKSTANIFATYLPEHMTLWRGFVDEVFVTGMLQLCIFAITDKLNSPALQGTEPLMIGILV----- 194

  Fly   182 CAIKLS-----GASMNPARSFGP---AVVQGVW---------TYHWVYWVGPIAGGLLAGIIY 227
            |.:.:|     |.::||:|...|   ..:.| |         .:.||..|.|:.|..|.||:|
  Rat   195 CVLGVSLGMNTGYAINPSRDLPPRFFTFIAG-WGKKVFSAGNNWWWVPVVAPLLGAYLGGIVY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 63/244 (26%)
Aqp7NP_062030.2 MIP 15..260 CDD:412216 65/248 (26%)
NPA 1. /evidence=ECO:0000250|UniProtKB:P55064 78..80 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:P55064 210..212 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.