DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and Aqp6

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_071517.1 Gene:Aqp6 / 29170 RGDID:71100 Length:276 Species:Rattus norvegicus


Alignment Length:218 Identity:91/218 - (41%)
Similarity:119/218 - (54%) Gaps:11/218 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IW----RMLLGELVGTFFLIFVGVGS-----TTSGSVPQIAFTFGLTVATIAQGLGHLSGCHINP 77
            :|    :.|..|.:.|...:|.||||     ....||.|:|.||.|..||..|.....||.|.||
  Rat    16 LWTAISKALFAEFLATGLYVFFGVGSVLPWPVALPSVLQVAITFNLATATAVQISWKTSGAHANP 80

  Fly    78 AVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNCAQAVLIE 142
            ||||.:|:...||:.:|..||..|..||..|||::.....|.....|||:....|.:..|||.:|
  Rat    81 AVTLAYLVGSHISLPRAVAYIAAQLAGATVGAALLYGVTPGGVRETLGVNVVHNSTSTGQAVAVE 145

  Fly   143 ALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWT 207
            .::|..||..|.|..| .||.: ||....:|.::|.|||..|..:|.||||||||||||:.|.:.
  Rat   146 LVLTLQLVLCVFASMD-SRQTL-GSPAAMIGTSVALGHLIGIYFTGCSMNPARSFGPAVIVGKFA 208

  Fly   208 YHWVYWVGPIAGGLLAGIIYRLI 230
            .||::||||:.|.:||.:||..|
  Rat   209 VHWIFWVGPLTGAVLASLIYNFI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 88/212 (42%)
Aqp6NP_071517.1 MIP 22..228 CDD:294134 87/207 (42%)
NPA 1 79..81 1/1 (100%)
NPA 2 193..195 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm45514
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.