DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and SPAC977.17

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_592788.1 Gene:SPAC977.17 / 2543301 PomBaseID:SPAC977.17 Length:598 Species:Schizosaccharomyces pombe


Alignment Length:263 Identity:73/263 - (27%)
Similarity:102/263 - (38%) Gaps:48/263 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KKIWRMLLGELVGTFFLIFVGVGST--------TSGSVPQIAFTFGLTVATIAQGLGHLSGCHIN 76
            :..:|....|.:||..|:..||||.        ..||...::|.:|..........|.:||.|:|
pombe   307 RHFFREGFAEFLGTLVLVVFGVGSNLQATVTNGAGGSFESLSFAWGFGCMLGVYIAGGISGGHVN 371

  Fly    77 PAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVI--------------KVALDGVAGGDLGVS 127
            ||||:...|..:....|...||..|..||..|.|:.              |.......||.| .:
pombe   372 PAVTISLAIFRKFPWYKVPIYIFFQIWGAFFGGALAYGYHWSSITEFEGGKDIRTPATGGCL-YT 435

  Fly   128 SFDPSLNCAQAVLIEALITFILVFVVKAV-SDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASM 191
            :..|.:....|...|.:.|.:||..:.|: .|......:|.....|||.|||..:.....:..::
pombe   436 NPKPYVTWRNAFFDEFIGTAVLVGCLFAILDDTNSPPTQGMTAFIVGLLIAAIGMALGYQTSFTL 500

  Fly   192 NPARSFGPAVVQGVW----------TYHWVY----WVGPIAGGLLAGIIYRLIFKLKKGCTPFQG 242
            ||||..||.:.  .|          .|||.:    |.|.|.||:..|:||.|:.        |.|
pombe   501 NPARDLGPRMF--AWWIGYGPHSFHLYHWWWTWGAWGGTIGGGIAGGLIYDLVI--------FTG 555

  Fly   243 HES 245
            .||
pombe   556 PES 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 66/240 (28%)
SPAC977.17NP_592788.1 MIP 311..520 CDD:238204 57/211 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I2575
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47106
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.