DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and Aqp2

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_037041.3 Gene:Aqp2 / 25386 RGDID:2142 Length:271 Species:Rattus norvegicus


Alignment Length:218 Identity:91/218 - (41%)
Similarity:130/218 - (59%) Gaps:6/218 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RMLLGELVGTFFLIFVGVGS-----TTSGSVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGF 83
            |.:|.|.:.|...:|.|:||     ::..||.|||..|||.:.|:.|.|||:||.|||||||:..
  Rat    11 RAVLAEFLATLLFVFFGLGSALQWASSPPSVLQIAVAFGLGIGTLVQALGHVSGAHINPAVTVAC 75

  Fly    84 LIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNCAQAVLIEALITFI 148
            |:...:|.|:||||:..|.:||:||||::.........|||.|::...:....|||.:|..:|..
  Rat    76 LVGCHVSFLRAAFYVAAQLLGAVAGAAILHEITPVEIRGDLAVNALHNNATAGQAVTVELFLTMQ 140

  Fly   149 LVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTYHWVYW 213
            ||..:.|.:|..|.|..||..|::|.::..|||..|..:|.|||||||..||||.|.:..|||:|
  Rat   141 LVLCIFASTDERRGDNLGSPALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGKFDDHWVFW 205

  Fly   214 VGPIAGGLLAGIIYR-LIFKLKK 235
            :||:.|.::..::|. |:|...|
  Rat   206 IGPLVGAIIGSLLYNYLLFPSAK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 87/207 (42%)
Aqp2NP_037041.3 MIP 3..219 CDD:395174 87/207 (42%)
NPA 1. /evidence=ECO:0000250|UniProtKB:P41181 68..70 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:P41181 184..186 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334446
Domainoid 1 1.000 193 1.000 Domainoid score I3090
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 196 1.000 Inparanoid score I3730
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm45514
orthoMCL 1 0.900 - - OOG6_100198
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.